PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000277.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 294aa    MW: 33325.6 Da    PI: 6.6738
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000277.1_g00004.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.21.3e-56201461129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              +ppGfrFhPtdeel+++yL++kv+++++ +  ++ evd++kvePwdLp ++k +ekewyfF+ rd+ky+tg+r+nrat++gyWkat
  Itr_sc000277.1_g00004.1  20 MPPGFRFHPTDEELISHYLCPKVADSSFCA-AAMGEVDLNKVEPWDLPWRAKMGEKEWYFFCVRDRKYPTGQRTNRATEAGYWKAT 104
                              79*************************988.78***************888999******************************** PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              gkdke+++  ++lvg+kktLvfykgrap+g+kt+Wvmheyrle
  Itr_sc000277.1_g00004.1 105 GKDKEIFR-AKTLVGMKKTLVFYKGRAPRGHKTNWVMHEYRLE 146
                              ********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.07E-6317166IPR003441NAC domain
PROSITE profilePS5100559.22520166IPR003441NAC domain
PfamPF023655.5E-3021145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0010029Biological Processregulation of seed germination
GO:0042542Biological Processresponse to hydrogen peroxide
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0048527Biological Processlateral root development
GO:0051091Biological Processpositive regulation of sequence-specific DNA binding transcription factor activity
GO:0090400Biological Processstress-induced premature senescence
GO:1900057Biological Processpositive regulation of leaf senescence
GO:1902074Biological Processresponse to salt
GO:1904250Biological Processpositive regulation of age-related resistance
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MENTSGSAFS GVEEEMELQM PPGFRFHPTD EELISHYLCP KVADSSFCAA AMGEVDLNKV  60
EPWDLPWRAK MGEKEWYFFC VRDRKYPTGQ RTNRATEAGY WKATGKDKEI FRAKTLVGMK  120
KTLVFYKGRA PRGHKTNWVM HEYRLEGNYS IPTHKNEWVI CRVFKKTAGG HKIHISGLTR  180
GENLPALMEV SQRTATSGEA MAPHVTCFSD SKEDKKPIIA PPHFSSPSPS SKNSDFSGVF  240
PGLEFQHYSE PDENSVLRLW LENNGLQAKQ GNDDDEFLMS SANGPVDLDC LWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-57111728174NAC domain-containing protein 19
3swm_B3e-57111728174NAC domain-containing protein 19
3swm_C3e-57111728174NAC domain-containing protein 19
3swm_D3e-57111728174NAC domain-containing protein 19
3swp_A3e-57111728174NAC domain-containing protein 19
3swp_B3e-57111728174NAC domain-containing protein 19
3swp_C3e-57111728174NAC domain-containing protein 19
3swp_D3e-57111728174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00535DAPTransfer from AT5G39610Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB8491260.0AB849126.1 Ipomoea nil EPHEMERAL1 mRNA for NAC transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006338435.11e-127PREDICTED: NAC domain-containing protein 92
SwissprotQ9FKA01e-107NAC92_ARATH; NAC domain-containing protein 92
TrEMBLA0A077JIT70.0A0A077JIT7_IPONI; NAC transcription factor
STRINGPGSC0003DMT4000033801e-126(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39610.11e-107NAC domain containing protein 6